DPCstruct | MC12614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 118 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0380 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3DQW8 | 1-114 | MSPLDFMQFRDYLTPASGFQSLQFRLMENKLGLKSEHRVRYNQHYSNVFHSNSEHLVALELSEQEPSLLNLVEKWLERTPGLEKDGF… |
| A0A0S7GWA5 | 18-138 | LVDQFAVLETMTALDFFDFRTYLIPASGFESLQFRLLENKIGVQDNLRVPYNRRHYKDYIKGDDTETLLETEQEPTLLKLVEEWLER… |
| A0A0C9QUM1 | 13-129 | None |
| A0A444SWZ1 | 19-135 | None |
| A0A818C5E1 | 18-154 | None |
| A0A820VJ78 | 124-242 | None |
| A0A3Q0IKU9 | 7-132 | None |
| A0A818EU36 | 28-139 | None |
| A0A822GMD0 | 132-241 | None |
| A0A814T6R1 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.