DPCstruct | MC12610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 135 ± 16 aa |
| Standard deviation of domain lengths | 15.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8Q0T3 | 2-131 | ETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALF… |
| A0A1S3DPT4 | 1-154 | TGILQILQTRTSRRFLQSRLTPEMERKLVFLTSNVKFGLQKRYQDWFTKQYLSTTESQALRYDVIRFIVGVIHPTNELLCSDIIPRW… |
| A0A183M5U5 | 23-160 | None |
| A0A200QTE4 | 2-110 | None |
| A9SW76 | 2-135 | None |
| A0A1I8F404 | 106-263 | None |
| A0A2I0KE63 | 180-293 | None |
| A0A6P4EMV3 | 2-131 | None |
| A0A1X2GGU2 | 239-391 | None |
| A0A0D3CSL9 | 177-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.