DPCstruct | MC1261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 194 ± 25 aa |
| Standard deviation of domain lengths | 25.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 53.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0R5Y3 | 1-171 | MVGERRNGNLLVQLGPRLQAYPEELIRQRRTHDGQTEYLIRWCLITIDDGSKTKPENILMWMSTEDVYANCPTLLGKRKTDSQLELS… |
| A0A4Z2EXW2 | 30-241 | ETTGTSVTRQVSPTHLGSGRGSGSIMVGERRHGPRRVQLGPRLQAFPEELLRQRRGHAGQPEYLIRWCLVAIHDGGSAAESEPENVL… |
| Q14999 | 1-193 | None |
| A0A2I4D982 | 21-273 | None |
| K7F993 | 1-178 | None |
| S4RIE5 | 1-199 | None |
| G3HYT3 | 2-189 | None |
| Q8BUW2 | 1-198 | None |
| A0A3Q2QHN8 | 17-153 | None |
| A0A480TWX5 | 1-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.