DPCstruct | MC12606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 205 ± 24 aa |
| Standard deviation of domain lengths | 23.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 70.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3DMK7 | 36-232 | SCMDVVEHPVALGPNQTPRPNTGPVYYTCILCQEEQALTKQNDALVLAAFVQQSTVMFRNRNADRTDFKVNSLYISLEHQGPAPHTS… |
| A0A834EJU5 | 41-261 | REKVMAQMSEMQRHFIDENKELFQQTLGLEASNSAVLDNSPMVSDVTLTALGPAQTQVPKQRQFVTCILCQEEQEVKVESKAMVLAA… |
| A0A368G0T2 | 545-749 | None |
| A0A5E4Q8P3 | 367-587 | None |
| A0A1I8IRT4 | 1-192 | None |
| A0A2D0QHA7 | 3-229 | None |
| C4JFX3 | 189-439 | None |
| A0A2P8YCX0 | 587-813 | None |
| J9BHF3 | 668-832 | None |
| A0A6L5DDM4 | 73-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.