DPCstruct | MC12605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 121 ± 16 aa |
| Standard deviation of domain lengths | 16.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 64.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 36.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05915 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2QBW2 | 1-104 | EPLPHAEMRERARYAQLHQHPPPLRGPKVPWKELALSVGLFLGGTTLLLFGIGMAYFQDASEALPLFMLGALLFIPGSYHSFIFLMI… |
| A0A7R8ZD66 | 95-215 | FHCTHNIIMSRRRPHTFNTDQYQSLPENDDFIDAQFESPKQEIPWKAVGLATMLCFGGTILLVVGSLLVSGHIDTKYADRTWPMIIL… |
| A0A6S7GIJ9 | 184-310 | None |
| A0A836D329 | 129-251 | None |
| A0A1Y2GFF7 | 1-135 | None |
| A0A2K6EIL2 | 61-179 | None |
| E9IHP0 | 4-165 | None |
| A0A2R6XWK8 | 23-129 | None |
| A0A7R9BKP8 | 333-440 | None |
| A0A2U3XS78 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.