DPCstruct | MC12604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 60 ± 3 aa |
| Standard deviation of domain lengths | 2.53 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 40.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0060 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8YDH2 | 84-143 | MEKPVLLTLALRYLISFTKATPLAKQVTISMSYGRPIVLEYKMEIMGHIRFYLVPKVEEE |
| A0A1S3DHT5 | 1-61 | MQEPVSLNFACRYLLNFAKAAPLSNQVCLSMSLDVPLVVEFKIDDIGHIRYYLAPKIESDD |
| A0A7E4S479 | 35-95 | None |
| A0A409XQP5 | 161-218 | None |
| A0A409XQE5 | 70-127 | None |
| A0A7I4AG96 | 148-208 | None |
| A0A4U5UH53 | 111-169 | None |
| A0A7J6HKB6 | 1-61 | None |
| A0A6C0E8N1 | 1-52 | None |
| A0A830BUK8 | 180-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.