DPCstruct | MC12602
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 268 ± 21 aa |
| Standard deviation of domain lengths | 20.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 49.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7KFB0 | 1-281 | MGMMISHDMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNLQSRDLALEVDRDRDQLIQQTMRQLNGH… |
| A0A1S3DG55 | 1-288 | MGQAVSHELLLGRWRLSLDLFGRVFMEDVGQAVSHELLLGRWRLSLDLFGRVFMEDVGLEPGSIVSDLGGFPVKEAKFRREMEKLRN… |
| A0A1I8NHT1 | 486-720 | None |
| A0A182T7T1 | 32-320 | None |
| A0A0S7KHF7 | 1-281 | None |
| A0A034VTC9 | 3-252 | None |
| A0A6I9Q3P3 | 66-329 | None |
| H2Y8X2 | 2-233 | None |
| A0A4D5RUE1 | 779-1049 | None |
| K1QR20 | 615-902 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.