DPCstruct | MC12601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 187 ± 20 aa |
| Standard deviation of domain lengths | 20.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6BGP9 | 10-204 | FDTVIVGNGPSALILSYILHGNIPYYARPHHDAILRSKLDRRPNLLHLTPDLYAHFLASLRYSTQALPINTLLDTLIRPNADTEVDP… |
| A0A1S3DFY5 | 17-188 | ISTQSEDPLFTDTVIIGNGPSGIALSFLLAGNWPFYNGDDHPDQLLNARLKTCSKHIPLLLQDLEFLSQSMEGRCKNQISNLMDALT… |
| E1C6X4 | 7-194 | None |
| A0A1W0X7S1 | 311-506 | None |
| A0A2I4D2J8 | 78-265 | None |
| A0A3M7M8I5 | 3-184 | None |
| A0A1D8NDI9 | 7-199 | None |
| A0A7J7VEV5 | 50-202 | None |
| A0A3Q2C825 | 7-146 | None |
| A0A8B6BZ21 | 353-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.