DPCstruct | MC1260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 113 ± 5 aa |
| Standard deviation of domain lengths | 5.02 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 88.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 42.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3G925 | 247-350 | KPENWDVWYESKFDECDKEACLSFSKEILCARVTVDHNYYAVCQNLLSRHATWRGTSGGLLHDPPSEIAKDGRLEALLDECANPKKR… |
| A0A4Z2EUN4 | 1-118 | MPNDKPENYDVWYESRFEECDREACLSFSKDSLCSRVTVDHNYYAVCQNLLSRYATWRGTTGGLLHDPPAHIAKDGQLLTLLDECTR… |
| A0A2A3EB19 | 260-372 | None |
| D4A3J1 | 82-196 | None |
| A0A3L8SA94 | 122-237 | None |
| A0A7R9AUN3 | 94-209 | None |
| A0A0L0BWM4 | 141-245 | None |
| A0A1W4XKS8 | 67-173 | None |
| A0A4S2KNE9 | 661-778 | None |
| A0A7R9HQT9 | 109-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.