DPCstruct | MC126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 85 ± 7 aa |
| Standard deviation of domain lengths | 7.30 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9RSU0 | 3-89 | TRSSKSMVTFFNAFAQPGYPGQLPAGTYEVIVEEELLQGLSFEAWRRISTYLIVHGKGNRGGSIAMRPITQKDLELVLRRDRIATET |
| A0A1G7AY89 | 1-99 | MNRNYKTHIVFIHPFAIAGYKETLPAGTYRLDVEEERIEGLSFTAFKRKEVTLHLNQNPKRPGVSEMLTLAPHEIDAAMVWDRRRDT… |
| A0A059DPY4 | 44-134 | None |
| A0A3N2QN73 | 3-79 | None |
| A0A4U6BGJ1 | 9-91 | None |
| A0A7W8GPU3 | 2-80 | None |
| A0A7W8GNP5 | 2-87 | None |
| A0A258GUS2 | 2-84 | None |
| H6SRC7 | 1-75 | None |
| A0A2M8QJX4 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.