DPCstruct | MC12599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 182 ± 24 aa |
| Standard deviation of domain lengths | 24.00 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 66.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16493 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485MWF0 | 28-166 | QDPNCSEPDVEGVSPPPAGSQTPMDADKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQEKEGKPFFCEDPET… |
| A0A1S3DF87 | 5-177 | TNQRGRPRKEYIRDVETAMGYQNYMEHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNEDIAVFSKQIRQEKPYYLADPEV… |
| T1DF70 | 5-178 | None |
| A0A369SH09 | 68-248 | None |
| A0A4C1ZL95 | 92-268 | None |
| A0A835NSL9 | 257-474 | None |
| S4R9G9 | 1-133 | None |
| B7Z4T5 | 22-206 | None |
| E7FBG0 | 3-224 | None |
| A0A1Y1NDT9 | 61-233 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.