DPCstruct | MC12598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 59 ± 3 aa |
| Standard deviation of domain lengths | 2.50 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 82.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 63.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9N0S0 | 1-56 | MVHITEDLIRRRAEHNECEIFSLEEVTLHQQDLEGIEHIERWCKELKILYLQNNLI |
| A0A1S3DD24 | 2-60 | VRISEDLVRKRAEHNDKEIGTLEEIALHQEHIEKIEALDKWCKHLRILLLHSNIISKLA |
| K8F2N9 | 4-63 | None |
| A0A177B224 | 1-59 | None |
| A0A6A4WKG2 | 232-295 | None |
| A0A5K3FHJ1 | 1-59 | None |
| A0A7J7KM76 | 1-59 | None |
| A0A7E6FHM8 | 714-778 | None |
| A0A2C6KVX7 | 1-61 | None |
| A0A7R9HKP4 | 8-62 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.