DPCstruct | MC12596
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 66 ± 2 aa |
| Standard deviation of domain lengths | 2.17 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 50.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3CRS1 | 35-101 | IMEIYGVPPPDVLALSQRRHLFFEKNNEPILTPNSRGKTRYPLSKKLEEILKCQDKNFLDFLNKCFE |
| A0A1S3D729 | 1-66 | MEILGCPPDEVINTASRRRLFFDSKGTPRCITNSKGRKRKPGSKDMASVLRCNDKAFVDFVTQCFK |
| A0A817ZMZ7 | 75-141 | None |
| A0A4C1W8L9 | 82-149 | None |
| A0A1Y2CPW1 | 558-625 | None |
| A0A811UGJ3 | 1-66 | None |
| A0A811XAK8 | 1-66 | None |
| A0A060WBE5 | 1-61 | None |
| A0A0J8QWU2 | 27-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.