DPCstruct | MC12595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 270 ± 15 aa |
| Standard deviation of domain lengths | 15.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 63.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1BQN0 | 81-361 | ANSHCQTAYPPLASNNLPPMQTQTEVPTVEPVQHMAPLQNKRMSVESQDSDELMMQLEKLFQGDANDDDLFEGALYDKLDTTQEDQT… |
| A0A1S3D4A5 | 1-276 | MKIPTIDEIRAYEESQRTQDCINVVPFLSAQDLNDVSSILDSLPLNLGQPGVSRYTNPDVLESHTAPPVLSLDQRLEQMKHVLPSAP… |
| A0A2J7PII2 | 270-525 | None |
| A0A834XM77 | 135-419 | None |
| A0A1A9WJL7 | 210-499 | None |
| A0A6J1ST40 | 29-277 | None |
| A0A6P8ZN71 | 1-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.