DPCstruct | MC12594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 136 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9LSY6 | 708-863 | GPKTPVPVTNLLIEKPRPFSCIRPLTQHNVYSYYLPLNGCVSYYAFSLHSSLPGGLFRLLPNSGVRVVNCLLFNSHIGIGVYLYMSR… |
| A0A1S3D0X6 | 17-152 | IKPFNQQNVMYYYAPIYGATNYALLSVNVMHPSLMYRIIPKHDVANVFLFTSVIGSGLYIHGRKHLQGAPQQLQVMFSAYGSLLFSF… |
| A0A2B4SUJ8 | 29-193 | None |
| A0A5N4A577 | 6-145 | None |
| A0A182W9D7 | 10-152 | None |
| A0A0N5ASZ3 | 1-125 | None |
| J9EZA6 | 6-158 | None |
| A0A1J1J7A9 | 6-136 | None |
| A0A212EV77 | 3-115 | None |
| A0A182Y217 | 62-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.