DPCstruct | MC12593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 232 ± 25 aa |
| Standard deviation of domain lengths | 24.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9K7G3 | 220-408 | LMAVPVTPSLVGNNLLDVVAKGYTVIASNQIQLWINSVGLIMAALPDSYWSVLHDRLISILSCPQLSTWKYRNTPFQLFNFNITHNA… |
| A0A1S3CZF6 | 3-224 | LPVPPEQVGNALLDVIMRGYTVIASDQIHAYINVLGLLMSALPDPYWTTLQDRLIRVISSPALVQGTTNCDIFALCNFNRTHNTLLG… |
| A0A446VMJ4 | 27-282 | None |
| A0A6F9DLE4 | 606-829 | None |
| W2T6D9 | 2-200 | None |
| Q10669 | 1152-1390 | None |
| A0A815WL44 | 2-228 | None |
| A0A183EFU4 | 34-245 | None |
| A0A0N4XKX6 | 43-304 | None |
| A0A1P6C0A0 | 1189-1419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.