DPCstruct | MC12590
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 176 ± 20 aa |
| Standard deviation of domain lengths | 20.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06784 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A154PDC5 | 17-174 | IENRAHRVISKEKPVPAPQYPSVTKQKELVDKLYPNYMEIHYKKNKQLDEHLKNVYVTSNDSVREPEGEAVSTKPLPQDRKHPPELQ… |
| A0A1S3CW97 | 3-181 | NLMTTAGRFMTRKMKRYNVENRALKFIEQDKMPIAPKHPSTVEMLESITKDPKVREELIRKNTDLDENLKHVYVKSLHKPVTNDDEK… |
| L9JVE9 | 46-217 | None |
| A0A132AD66 | 8-208 | None |
| E4YYM2 | 11-212 | None |
| A0A1B6K9N0 | 21-177 | None |
| T1FN05 | 15-176 | None |
| A0A194QRV1 | 616-808 | None |
| A0A2R9BF79 | 9-147 | None |
| A0A0K0EHY5 | 4-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.