DPCstruct | MC1259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 158 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672V1X7 | 1048-1202 | FELASAAGIPCEVDPALVHVLAGSKTDGPSPEEDYKVACLLLVFVAVSLPLSQHSRVPPGFPNNIHCLAKAITHLSAALFTVHNKNI… |
| A0A2G9UIS1 | 1-166 | MGVQGPVDVALANAVRAQSLQINPDEHYQMSCLLLVAIAISLPKLALIESATYKPSLRASLNNTHCIPLAVNTIAGALFHHHGRGDT… |
| E4YFI0 | 177-347 | None |
| A0A0R3R539 | 144-299 | None |
| A0A4W3GXU8 | 50-204 | None |
| A0A0R1E8J9 | 282-449 | None |
| A0A7S2FP60 | 13-165 | None |
| A0A0D6LBC9 | 177-344 | None |
| A0A0S7HY82 | 53-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.