DPCstruct | MC12585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5ZF41 | 1-96 | MWVQIEKVVLEAKERTAKIPEDTLKCDYIMRLNGILIEGEAVKGNEVIIKTLTGRTITGTFKERLPEYGHDFGKPVEELLHIGPVHR… |
| I6Y0F7 | 7-94 | APEGAWVEIQQVVLTPGERAEGVPADTAATPLLQWVDGFLTAPAALGEEATIRTIIGRTHTGVLSRINPGYSHSFGETVDEILTIGTE |
| A0A355BK45 | 32-131 | None |
| A0A536BY48 | 15-113 | None |
| A0A3C0T3J1 | 1-85 | None |
| H5UTL4 | 5-103 | None |
| A0A536IBX8 | 2-82 | None |
| X1NXQ8 | 15-111 | None |
| A0A7S7J276 | 1-100 | None |
| A0A2N1PLN1 | 3-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.