DPCstruct | MC12584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 122 ± 21 aa |
| Standard deviation of domain lengths | 20.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3KXD1 | 7-124 | LIPKSKFDFGAIQRLQQLDPQALIPILSELLVWLQDINWPVAIPMSKILLIVPNEIVPHVRNVLHTNDSEWIEWCLQYIVSFLPVAL… |
| C4GK27 | 6-116 | PRDKFDLDAVAALAGVDGATLRPLLPDLLAWLQDANWLIAAPLADVLRPHQQAFDAELAAVLRGEDAVWKVSLLAGLLDYRAGAETV… |
| A0A516W982 | 83-213 | None |
| A0A3P3U6P5 | 3-74 | None |
| A0A072NN68 | 1-99 | None |
| A0A519TDS9 | 9-190 | None |
| W0IPC7 | 123-241 | None |
| A0A0Q6GI78 | 42-172 | None |
| A0A1H9CWR3 | 13-125 | None |
| A0A1G3KRL8 | 3-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.