DPCstruct | MC12583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 114 ± 9 aa |
| Standard deviation of domain lengths | 8.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0327- PF07963 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B2LX27 | 7-117 | SSKHYPDQGLTLLEVLLSITLLVIIASIAVPSVSYQLQRRESDQVQQTLSKLLQLAKLEALSRQQNIVLCASTDLQNCQAQAWHNGL… |
| C4GH22 | 5-129 | KRVQGFTLLELMVTVAIMAIMAAIAFPSMRDFVSNSRLVNRSEQIANAFRFARTEAVRMNTPVLLCGVLIRKDGRNTGVCDETKISD… |
| A0A525CME0 | 21-143 | None |
| A0A5E4PEM5 | 1-107 | None |
| A0A534G5F2 | 17-119 | None |
| A0A0M9HHC1 | 1-99 | None |
| F5S631 | 1-123 | None |
| A0A433K192 | 35-151 | None |
| A0A7Y0GGH5 | 1-109 | None |
| A0A6N8EJ81 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.