DPCstruct | MC12582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 69 ± 3 aa |
| Standard deviation of domain lengths | 2.97 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 54.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4XUA9 | 293-362 | INRNKKELMCNAYRNYAGTWLINPMFIAPKGHLASGYPCSTTACVDEHGAAVPCLDEAGAVIPDQADNVY |
| A0A5P2UX77 | 1-73 | MLNRNENEVMCRAYDDSDGEWIVNPMSIEPKPRKTDPYPCSTTGRIGRDGAPGPVRRDDAGVIPDQADRVHPP |
| K0UP59 | 200-266 | None |
| X8FK43 | 4-73 | None |
| A0A1S6R771 | 56-119 | None |
| A0A655IPR1 | 127-196 | None |
| A0A7K3DVF4 | 319-390 | None |
| A0A7W0QER8 | 9-78 | None |
| A0A229GRT6 | 69-138 | None |
| A0A1N5LLB7 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.