DPCstruct | MC12581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 107 ± 16 aa |
| Standard deviation of domain lengths | 16.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2CQY8 | 5-84 | IARGEENKDVIDWDEYTIVGLCQKLEKSYLRLTSAPDPATVRPLPVLRKTLDLLGQKWKQDQNYTYICDQFKSLRQDLTV |
| A0A7S3Z487 | 1-120 | MLAMRGRDVISLKRKTPPASSSLQDHLRKLQASFASLPSKAGWKRTKRDSTSKTTAIIGTSTTLEKRYLRTTDAVDPSKVRNRATCV… |
| A0A7S2C3X0 | 8-99 | None |
| A0A2I1GYE2 | 69-201 | None |
| A0A068SC61 | 149-249 | None |
| A0A811NXV4 | 1-80 | None |
| A0A7S1ZFJ1 | 1-111 | None |
| A0A5K3ERC2 | 108-241 | None |
| A0A817K171 | 1-110 | None |
| H2YWJ2 | 3-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.