DPCstruct | MC1258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 49.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3JHQ6 | 16-111 | MNPKSKLSELPLKRFYRMVLEPSVQFDDSGRISSAAYQARFASLPSKQLLTLALIPSDSWMVQAVKAVYDLDNIKMQNVEGNVVSEF… |
| A0A4Z2ETD1 | 1-86 | MNCQSKLSEMPLKSFYRHVLEPEVAFQADGAFSPGPMAKFLDMPQSPLFTLNLNTPDSWMVESVHTRYDLDNIYLEEVKRHVHQDP |
| A0A2I0T403 | 176-253 | None |
| A0A482WZN0 | 72-155 | None |
| A0A368G9W3 | 162-239 | None |
| A0A7R9C3E3 | 410-494 | None |
| A0A0K0FWP3 | 510-592 | None |
| A0A2P4T730 | 444-525 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.