DPCstruct | MC12579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 213 ± 34 aa |
| Standard deviation of domain lengths | 33.52 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9R557 | 299-521 | TPNGRQEFDKLVKSLNQNEEKTLLASVIESIYKLCADLHHTTYEVIFAPIFTQLVLIQRAPAWFGDGAKVQGLSSDLPDYSFAPQEY… |
| A0A7S3YWV5 | 1-180 | GDDGHAASSSSSSSFVLQLGRQEANAVLLLGESLVFQAMMQPINAQLRNLHTWGVWREKADDAKTLALPLFTVQPSDYVTRIGEHML… |
| A0A817ZV02 | 34-229 | None |
| A0A7J0ED57 | 347-540 | None |
| A0A7S0WLI0 | 4-185 | None |
| A0A2P4YR70 | 21-236 | None |
| X6M7G7 | 40-253 | None |
| A0A5D3DJ26 | 566-796 | None |
| A0A553PB03 | 453-691 | None |
| A0A6A0HBC4 | 98-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.