DPCstruct | MC12577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 17.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08854 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4S4F2 | 1-93 | MLGICAASAEEGLAALKTWTAELGLPKGKLHGMDKDGIPVDPPKGAVFIKYNSLSGDAYISGYGGTFRGVLFTPELDDGAFRQYGYL… |
| A0A7S3YGR7 | 26-131 | KRALWESAKLMKKMSTSIGLGIHASTPERGIRELEGWVLGLHLKHNELHRYDEDDPIRGPVYIRYSSRTGDAYLRENDGKHQGVEFA… |
| A0A7S4DIA7 | 25-131 | None |
| A0A560L8D4 | 7-111 | None |
| A0A1Z4JNB1 | 24-126 | None |
| C1FJC1 | 124-258 | None |
| A0A563VUB1 | 26-141 | None |
| A0A7S4A840 | 64-181 | None |
| A0A0D2MDH1 | 31-124 | None |
| A0A7R9Y3V2 | 43-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.