DPCstruct | MC12575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 128 ± 19 aa |
| Standard deviation of domain lengths | 19.45 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 74.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A086J9U8 | 20-136 | SAGAVHTWKWTVTGFSLFYANVRVSYQLLKKKILGHPLRYNEHKLLVRTTADALKLIPFSLMIIIPLGELLLPVVLRLFPNMLPSTF… |
| A0A6V3P2G2 | 1-154 | MADIADEDELTVLESQVLSFKERLGLANTNLQVDFSSVRKAWKDTVTKLRMALSFYVLGTKLLGNDIQYALWLIARAIDGDTLKPRE… |
| A0A3P7LH24 | 1-116 | None |
| A0A7S0Y556 | 207-356 | None |
| A0A7S2SGM0 | 230-354 | None |
| A0A7S1LXA8 | 1-117 | None |
| L1JBY8 | 2-118 | None |
| A0A5M9MTV1 | 138-248 | None |
| A0A4S4N4E7 | 2-106 | None |
| A0A1B7SG43 | 5-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.