DPCstruct | MC1257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 68.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3VTU8 | 68-129 | TEKRPKKNKYSTKSKRPTPPANCVPLWGSCKTPNAVCCEYCAQCHCRIFKTVCYCRMGYPGC |
| F1LQS7 | 28-97 | ISRKEAEKRKRSSKKKASIKKVARPPPPSPCVATRDSCKPPAPACCNPCASCQCRFFGSACTCRVLNPNC |
| L5LT97 | 99-169 | None |
| A0A667YMF6 | 45-107 | None |
| A0A6F9BWN1 | 1-61 | None |
| A0A190X674 | 99-157 | None |
| A0A4Z2HW24 | 92-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.