DPCstruct | MC12569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 145 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 30.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0500 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9RFE9 | 2-150 | LRKHKLFSILLVAILAACVNLPTGPSVMVLPGSSKSFEQFRYDDYECRRYAYEQVGGVTAGKAATSSGLTSAAAGSGLGAAAGAAIG… |
| A0A0D6N581 | 48-184 | MKLKTASAFLLPALLLTACAETPMGPSVMVLPSQGKSYATFSQEQNFCRSQAATAVSGQAERQNHRAILGGLATTALGAGLGAAAGG… |
| A0LF04 | 2-117 | None |
| A0A847J909 | 7-155 | None |
| A0A349L438 | 19-136 | None |
| A0A0T6A1P3 | 1-152 | None |
| A0A4R7E0P3 | 23-190 | None |
| A0A4R7ADY4 | 5-127 | None |
| A0A5E4TTP8 | 28-186 | None |
| A0A7U6Y456 | 18-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.