DPCstruct | MC12566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 144 ± 15 aa |
| Standard deviation of domain lengths | 15.15 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 31.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380EEG5 | 4-142 | NERIEKGYQAFVKDDYTQVLNTYDDLDGKKLDKEALYIYAKSYIQTNKQGLEKDKKENLLNNVTPNSNKDYLLYWMELGQGHLDEAI… |
| T0TBK1 | 18-157 | KNAVIDAQAAFMSTDYDKAIDILEPYGINRLPKSAKYVLATSFVKLDNLNSEQMEAVLNTITQSSDETILNYWIYLGRGDLEKALDV… |
| A0A0A5GD23 | 247-393 | None |
| R3KK15 | 165-298 | None |
| W7C4S1 | 186-333 | None |
| A0A5R8LX43 | 1-112 | None |
| A0A2C1KG57 | 173-323 | None |
| I0R8M8 | 2-123 | None |
| R6PXC0 | 72-219 | None |
| Q7A1V2 | 228-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.