DPCstruct | MC12564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 89 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S0WVS0 | 11-94 | VDFEDRLLSHLQIVIVQRFRRNESLVISWLDAASVGDGRSSLWMTPTQPVYFKFAGSRVPAIDEQWLQRLSESAASSSGLIVTA |
| A0A1V2NNJ9 | 11-108 | AIEIEDRGLRHLQVAIMTKLRRDERFTFSWGDEPLVGGDVALEGGEGKYGTVWLSSAASLYFSYDAFPAGPLNKTWVEALLEIANRT… |
| A0A0E3XP98 | 20-107 | None |
| A0A2H1ILQ5 | 2-108 | None |
| A0A2S3Z695 | 1-97 | None |
| A0A1R4KN75 | 11-82 | None |
| A0A2S5XDZ8 | 1-102 | None |
| A0A653X561 | 1-105 | None |
| A0A1H4BXX1 | 4-90 | None |
| A0A1R4ET08 | 13-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.