DPCstruct | MC12560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 14 aa |
| Standard deviation of domain lengths | 14.03 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0651 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6EX99 | 1-84 | MNARTQVFELSVEGRQIEEVVESIFHTLLLHRTIGKFHFKQESSYSIGTVGIVDVDCDFIDFTYVRTASDELDRKLKGHVSLFR |
| I1R605 | 1-57 | ILHTIFFHRTLSLVRPKDVDCDFFEITYVQCGLPELEKEVDEKINQFVAWVEKHPNR |
| A0A2P2KGC5 | 1-85 | None |
| A0A0R3RW69 | 11-113 | None |
| A0A182R0U7 | 401-487 | None |
| A0A3L6PFA5 | 51-119 | None |
| A0A2G5UD12 | 1-97 | None |
| A0A7R9I5Y8 | 47-153 | None |
| A0A2P6V6Q8 | 10-82 | None |
| A0A811Q5G0 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.