DPCstruct | MC12559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 189 ± 48 aa |
| Standard deviation of domain lengths | 48.20 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.85 |
| Pfam Score | 97.50 |
| Assigned Pfam label(s) | CL0020- PF12807 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453FK54 | 197-352 | EVALPKLVADFGSLELSPVDGRTLTDFMHTRGLQMRSLGRVVKLSEKLSHVQSLCVHEMIVRAFKHIVQSVIAATSDMRQLALTIAA… |
| A0A453D8K5 | 2-161 | YDDTALPKLVADFASLELSPVDGRTMTDFMHTRGLNMCSLGRVVELAEKLPHIQSICIHEMVIRAFKHVIRAVIAAVDDMQNMSAVI… |
| A0A453FKA4 | 10-170 | None |
| A0A453PF02 | 134-306 | None |
| A0A0K0E7J3 | 1419-1601 | None |
| E7FE02 | 1068-1370 | None |
| A0A7J0G7M0 | 565-726 | None |
| A0A3Q1EZR2 | 704-983 | None |
| F4PP85 | 770-1007 | None |
| A0A7S3GK75 | 883-1044 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.