DPCstruct | MC12556
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 98 ± 7 aa |
| Standard deviation of domain lengths | 7.47 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 67.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392M3E4 | 1-84 | MSCLMINDIDAGLGRFGNTQMTVNNQIVVGTLMNLCDNPTRVSVGQDWRESDITHRIPIIVTGNDLSTIYAPLIRDGRMDKFYW |
| A0A453D5X2 | 1-103 | MSCLMINDLDAGLGRFGHTQMTVNNQIVVGTLMNLADNPNRVSIGQKWRESDITHRIPIIATGNDFSTLYAPLIRDGRMEKFYWQPT… |
| A0A7S3VM66 | 1-102 | None |
| A0A4D6N4T1 | 492-594 | None |
| A0A7R9TAG2 | 44-145 | None |
| A0A2P5WWC2 | 49-132 | None |
| A0A2U1PJJ0 | 35-136 | None |
| A0A1U8N7L8 | 1-82 | None |
| A0A1C0UZR5 | 32-123 | None |
| A0A835N0Z2 | 297-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.