DPCstruct | MC12554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 4.76 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 51.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5GZW1 | 458-519 | IQKLVFMDTAEGVTTALRPYWSKATGDSATVVQTVPDMLEIVPPGTSKGRGVNMLLDHLGVT |
| A0A453D453 | 11-82 | SSIQKLLFLGNTDEDFSVLTQHWSELTEGKACVIKEQPNAIEIVPLNSSKGGGIMVLLDHLGLTEDSDLEAV |
| A0A5D3E550 | 480-547 | None |
| A0A2N9GT09 | 1040-1104 | None |
| M7YN13 | 563-630 | None |
| A0A835XRP8 | 693-758 | None |
| A0A0E0IIV8 | 174-252 | None |
| A0A2P6TVV2 | 385-448 | None |
| A0A3L6FFV2 | 759-826 | None |
| A0A6V7QK16 | 183-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.