DPCstruct | MC12552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 216 ± 30 aa |
| Standard deviation of domain lengths | 29.92 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287J830 | 402-561 | DVLLYNFFGSSPLRNKWRVLYGYMKDKDIIAHSEEISHPGFDRTKHYLLCSELKQLYVAVTRTRQRLWICENTENYCRPMFDYWKKL… |
| A0A453CVH2 | 3-196 | LLYNFFGSSPLRNKWRVLYGYMKDRDIISHSEEISHPGFDRSKHYLLCSELKQLYVAITRTRQRLWICENTEDYCRPMFDYWKKLCL… |
| A0A0P0WE98 | 1323-1551 | None |
| A0A1R3HQH9 | 199-396 | None |
| A0A4Y7JJZ6 | 170-416 | None |
| U9TRY7 | 1013-1274 | None |
| A0A6S7FTA4 | 29-199 | None |
| A0A433Q977 | 216-450 | None |
| R1BPP2 | 32-261 | None |
| A0A1E3Y423 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.