DPCstruct | MC12551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 84 ± 4 aa |
| Standard deviation of domain lengths | 4.00 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 52.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453CVH2 | 118-196 | KLFNEGQFEMATMCFEKAGDAHREKLARAAGLVATANRVISTNLELGKASLQTASEIYESIGMHEKAATCYIKLGDYKK |
| A0A453CV75 | 1-91 | LFNEGQFEMATMCFEKAGDAHREKLARAAGLVATANHVISTNLELGKASLQTASEIYESIGMHEKAATCYIKLGDYKKAGLSTLIIS… |
| A0A6A1V3C9 | 33-117 | None |
| A0A7J6W032 | 116-200 | None |
| A0A4Y7INR1 | 607-691 | None |
| A0A4Y7JJZ6 | 290-375 | None |
| A0A0P0WE98 | 1450-1532 | None |
| G7JNG7 | 2-74 | None |
| A0A4Y1RYG8 | 1064-1148 | None |
| A0A445H4P3 | 152-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.