DPCstruct | MC12550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 122 ± 11 aa |
| Standard deviation of domain lengths | 11.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J1W6M0 | 66-201 | MDSLLKKYQPVSPVDAQPHWESSYDFSLKHCNHAVWNRNCKVVQEGKECFQGARLRHYYMLCGALLRVWTKIASIMANITNTSYLQI… |
| A0A453CSC3 | 5-121 | SELKGKYRKVSSIDKVSKGWQDEYDVSSKQCMHGSKCKVGSYCTVGRRLQEFNILGGLILPVWGTIEKALAKQVYQNHKRIRVVRLV… |
| A0A812EQ48 | 96-216 | None |
| A0A7R8WF20 | 350-482 | None |
| A0A7J7XL06 | 712-841 | None |
| A0A383VFB9 | 631-759 | None |
| E9HLM0 | 493-598 | None |
| A0A6J1PZ46 | 450-566 | None |
| A0A3P7J1W2 | 1-123 | None |
| A0A3L6VME2 | 157-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.