DPCstruct | MC1255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 5.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 61.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A354TAD6 | 10-64 | STPPYAEFLAELDEIQRLKWIASENAGQDIGFEHALNDWAQNHRAEWRRMRNLIV |
| A0A5E6MQB5 | 8-72 | DSSPREGESLFMNSALYREYLEERKEILKHKWLESEKQGRDIGFEKALLDWILHHRAGWRERRRL |
| W0J5G7 | 3-72 | None |
| A0A432FFI1 | 1-53 | None |
| A0A3M1GKD5 | 35-92 | None |
| A0A348S4K8 | 24-90 | None |
| A0A3E1DX15 | 57-122 | None |
| A0A290Q9L0 | 7-71 | None |
| A0A4Y8PFU1 | 11-69 | None |
| A0A383CPA8 | 8-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.