DPCstruct | MC12549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 181 ± 16 aa |
| Standard deviation of domain lengths | 16.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 46.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12397 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K9Q0A0 | 131-268 | EKSQKIFVQTRDLSGILARLSQDYNIEKLLYIYLHTLIDYSSSDDAYCSTLVSSLETIPAKDSVTSIVAKVLISCLRLSQKTEVNHL… |
| A0A453CQ04 | 1-193 | SQSVQEFRKKPLMILKDIRDFSGVLSVLSSEFNIENFVRLYVESLVDCSTSDESCHVHLIETMETLPIKNFVERIVRKVLGNCIKAS… |
| A0A6J0N6F9 | 313-501 | None |
| A5AUU3 | 13-206 | None |
| A0A453CQA3 | 116-307 | None |
| A0A4S4EYX1 | 1-172 | None |
| A0A287J3G7 | 54-245 | None |
| A0A6A2Z869 | 131-307 | None |
| A0A830AZM9 | 103-277 | None |
| A0A453CQ36 | 55-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.