DPCstruct | MC12546
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 354 ± 84 aa |
| Standard deviation of domain lengths | 84.06 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14661 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2KB89 | 18-222 | YTNCLLLGMDPNIIGLGASNGTPRVGLFRHSNPKLGEQLLYFILSSLRGPAQSAKDFDKVWPIFDSAQSRDFRKVVQGIISELESHG… |
| A0A453CK87 | 11-353 | AELEGAMYTNCLLLGLDPAVLGSPAGAGAAPARVGLFRHSNPRLGEQLLYFLLSSLRGPAQSAKDFDKVWPIFDSAQSREFRKIVQG… |
| A0A1X2IKX9 | 16-290 | None |
| A0A835HC20 | 2-260 | None |
| A0A4U0VF67 | 43-460 | None |
| A9TQG5 | 76-570 | None |
| R1E6V0 | 34-518 | None |
| A0A7I8VUL7 | 10-369 | None |
| F1NQ15 | 6-427 | None |
| A0A452IP24 | 2-328 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.