DPCstruct | MC12545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 4.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 60.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835F5P7 | 143-198 | LFVKASSRPLDILPFLRSLAGFPAHEEIELYEEIQFKPFVWCETIDIHMTFKDSQI |
| A0A453CK26 | 159-217 | YIGMLFVKASSRPSDILPKLRSLAGFCADEEMELYEEIKFEPSAMCEAIDANITFSESQ |
| A0A1U8FLH3 | 60-116 | None |
| A0A2U1NI33 | 44-92 | None |
| A0A453I3E5 | 387-435 | None |
| A0A453HJ13 | 85-140 | None |
| A0A287I3K1 | 98-152 | None |
| A0A446M830 | 191-245 | None |
| A0A811MX62 | 49-108 | None |
| A0A5J9WDY4 | 136-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.