DPCstruct | MC12544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Standard deviation of domain lengths | 8.04 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12076 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9UQ97 | 297-383 | LYIIRKPNLRTKIVDGTSLAVAAVLHLIPQGTKDVHLLGNASKMSFVLTLALCEREIQVQIADTDLYDCLKQELRPEMHKHLVLSCT |
| A0A453CII5 | 9-101 | GELFTQKYPKLRVRLVDGSGLATAVVLKSIPLYTKQVFLFGSSSKVAHATATALCKRGVQVIMNQKNEYDMLKLRVLESSTAYLKFS… |
| A0A7J9EZN0 | 3-98 | None |
| A0A1R3J5R9 | 304-397 | None |
| A0A7J0FWP5 | 42-133 | None |
| A0A1D1YK90 | 178-262 | None |
| A0A6V7PAI6 | 9-98 | None |
| A0A1U8PU78 | 366-452 | None |
| A0A5B6WA41 | 139-230 | None |
| A0A7J9KHH4 | 2-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.