DPCstruct | MC12543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 171 ± 15 aa |
| Standard deviation of domain lengths | 15.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 67.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813K8H6 | 417-588 | VAQAILQTLIERQAVEEALSGTWPHFFAVGLGLLYLGQQDSCEATLAALDAISHPVGKYAKLVVEGLAFCNSGDVLHVQKMLQACTE… |
| A0A2A2JNK3 | 355-551 | VAMELLQFLMERSEAELQDTNMRFIALGIALIFLGTQEKSDVFVESLKSLPTPFGQMVSTLVDVCSYAGTGNVLKIQNLLHMCSEHY… |
| A0A0R3QEV7 | 1-183 | None |
| A0A7J7N1X8 | 210-360 | None |
| A0A6A3CW79 | 273-441 | None |
| A4I449 | 511-700 | None |
| A0A7J8LQ48 | 145-295 | None |
| A0A7J8RD41 | 145-295 | None |
| A0A7J6YL94 | 894-1067 | None |
| A0A438EGI4 | 682-833 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.