DPCstruct | MC1254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 69.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J0GGD1 | 3-57 | ADSKVETIARLAQWRIDNFGPCTYKKSDPFRVGIWNWHLSIEKNRYMYIRLFPEL |
| A0A7J7P034 | 1-58 | MSDSKVETISRLAQWRIDNFGPCTYRRSESFKVGLWNWHLSIEKNRYLYVRLFPSQVE |
| A0A438K0G4 | 3-57 | None |
| A0A3L6RFZ4 | 7-62 | None |
| A0A4S4D6M5 | 317-377 | None |
| A0A6A3BEK3 | 1-54 | None |
| A0A7J7MD56 | 1-54 | None |
| A0A6S7PKM1 | 2-57 | None |
| A0A5J9W6S6 | 14-69 | None |
| M8BNR8 | 10-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.