DPCstruct | MC12539
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 152 ± 23 aa |
| Standard deviation of domain lengths | 23.44 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4M399 | 210-345 | VDFYDRPTEAMWFHIPRHRRALIALLLNLSYVGHISAVVCTVVYWEYIETQTWPGMFAINLPAMTSIITIITAAVLQGNAEAKLVAE… |
| A0A7S3BQ32 | 155-279 | DFYGRPSPALWFAIPPRKRAYIVVFLVSNAVLQFAHQVLHITNNTYQSSFIDQPAASLLPLTMVTSGTAGFLAGALEFLEENKLRKA… |
| A0A7S3F1N6 | 1-196 | None |
| A0A7S3AZ11 | 68-200 | None |
| A0A7S3F8Y8 | 116-297 | None |
| A0A7S4K6Q9 | 5-156 | None |
| A0A0M0JUM4 | 106-276 | None |
| A0A0M0JH79 | 127-260 | None |
| A0A0L0GCM1 | 209-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.