DPCstruct | MC12538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Standard deviation of domain lengths | 14.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T5Y014 | 3-148 | ARRHVNSPDRARGNARVPDFMDIAGISPLSSSIEIALGAGRAGLLLIEAALPEAAVETEWSPAYSEAWRNVVKTATGPSTLMACAFL… |
| A0A7S0FNT1 | 20-188 | FDTRGDGVPSSLEGMVAAKYLNSANRERGSAPVPNFSDAISVGPGATIEDESIGKLKAGLLLIEAALPRGSIDSSVWTSEKANSWRS… |
| A0A328DSB9 | 543-661 | None |
| A0A7C9AXZ8 | 72-237 | None |
| D5AAM6 | 1-133 | None |
| A0A7N0VBK3 | 1063-1189 | None |
| M7XDN0 | 52-178 | None |
| A0A6V7PM20 | 213-348 | None |
| A0A022RYE4 | 178-306 | None |
| A0A662XLF3 | 320-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.