DPCstruct | MC12537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 175 ± 15 aa |
| Standard deviation of domain lengths | 15.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2V5Z5 | 92-258 | TSGLVSGGPSVFSPMSSRMFRSSSLGPGSFDMSLDLSNSIAATMGPATIGSFSETPLMLPDPAESSVHYILAKPLLSPAVGLVGFPA… |
| A0A7S0B0F5 | 1-151 | VPGNAAAKSGSSYRPQSSGVSTRQSSIGIVEPATTSDRDEPTRDEIFYILAKPFKSVSTGEKLGFPSYNAEREMIGFVRESNQKGFG… |
| A0A2P4X1L4 | 357-540 | None |
| A0A1E7F6W8 | 583-755 | None |
| A0A7S2RFX6 | 40-222 | None |
| D8LAY1 | 118-313 | None |
| A0A2D4C7Q3 | 1-188 | None |
| A0A3R7HHC1 | 353-530 | None |
| A0A397BBK1 | 121-301 | None |
| A0A7S0H226 | 509-654 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.