DPCstruct | MC12535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 163 ± 37 aa |
| Standard deviation of domain lengths | 36.71 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5BUP3 | 38-154 | QALRGVRYTPKGDCPQCNKKMTPVEIIRGFNQDPNDFTTRCARRRCGYRFTPILAYSMGAIQAEIPFYCAAQTLARLPGKETLSPER… |
| A0A7S0ALH4 | 35-210 | KAPTLEDKAFVSEAVLRQILLGESLLEIVYPDISIDTDNELCPRCNKLLTDDEVVAGWTNGNAQDYTTKCSVCSQRFVPHFCVQSTA… |
| A0A7S1GQA7 | 430-601 | None |
| A0A397EPX4 | 109-248 | None |
| A0A7R9WPA5 | 24-192 | None |
| T1PHX7 | 491-682 | None |
| A0A7S3LP97 | 255-390 | None |
| A0A1R2CCX9 | 113-267 | None |
| A0A7S2HM36 | 2-142 | None |
| A0A1G2NWT5 | 40-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.