DPCstruct | MC12533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 175 ± 13 aa |
| Standard deviation of domain lengths | 13.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z5JMK7 | 228-388 | QEFVALSLAGYRNRMIRMNVHIGIAGLTFGFGTTVAGFFGMNLMNGLETSPIAFDYVVLSAVGGGGLIAVGALNYLSGSAMQKRASK… |
| A0A7S0AJ41 | 3-171 | ELVAISLDSHRNRMIRMNVSLAIVGVGLAVGTTVAGAFGMNLISGYEDSPTAFNTVMWSTSITSLVVVFGCTSYLSGSRMKKRAMER… |
| A0A7S4DYR3 | 65-239 | None |
| A0A7R9WR17 | 1-165 | None |
| A0A7S4HRH7 | 186-377 | None |
| A0A0K2UMS4 | 111-268 | None |
| A0A836C9F9 | 323-510 | None |
| A0A7R9VDH7 | 37-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.